Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries) |
Domain d1bb7__: 1bb7 - [36593] complexed with gum |
PDB Entry: 1bb7 (more details), 2 Å
SCOP Domain Sequences for d1bb7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bb7__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)} kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl rsyvagcgv
Timeline for d1bb7__: