SCOPe 2.07: Domain d6id1c3: 6id1 C:582-659

Lineage for d6id1c3 (6id1 C:582-659)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.0: automated matches [254210] (1 protein)
   not a true family

6. Protein automated matches [254469] (4 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [365902] (3 PDB entries)

8. Domain d6id1c3: 6id1 C:582-659 [365928]
   Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c4, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
   automated match to d3jb9b3
   complexed with gtp, i6p, mg, zn

Details for d6id1c3

PDB Entry: 6id1, 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution

PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id1c3:

Sequence; same for both SEQRES and ATOM records:

>d6id1c3 d.58.11.0 (C:582-659) automated matches {Homo sapiens [TaxId: 9606]}
fnttsvikiavepvnpselpkmldglrkvnksypslttkveesgehvilgtgelyldcvm
hdlrkmyseidikvadpv

Timeline for d6id1c3:

• d6id1c3 is new in SCOPe 2.07-stable
  
• d6id1c3 appears in the current release, SCOPe 2.08