Lineage for d6id1c2 (6id1 C:440-581)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402871Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2402872Protein automated matches [226946] (29 species)
    not a true protein
  7. 2402935Species Homo sapiens [TaxId:9606] [365900] (3 PDB entries)
  8. 2402936Domain d6id1c2: 6id1 C:440-581 [365927]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jb9b2
    complexed with gtp, i6p, mg, zn

Details for d6id1c2

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1c2 b.43.3.0 (C:440-581) automated matches {Homo sapiens [TaxId: 9606]}
spkvgakpkiehtytggvdsdlgeamsdcdpdgplmchttkmystddgvqfhafgrvlsg
tihagqpvkvlgenytledeedsqictvgrlwisvaryhievnrvpagnwvliegvdqpi
vktatiteprgneeaqifrplk

SCOPe Domain Coordinates for d6id1c2:

Click to download the PDB-style file with coordinates for d6id1c2.
(The format of our PDB-style files is described here.)

Timeline for d6id1c2: