Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Homo sapiens [TaxId:9606] [365900] (3 PDB entries) |
Domain d6id1c2: 6id1 C:440-581 [365927] Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ automated match to d3jb9b2 complexed with gtp, i6p, mg, zn |
PDB Entry: 6id1 (more details), 2.86 Å
SCOPe Domain Sequences for d6id1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id1c2 b.43.3.0 (C:440-581) automated matches {Homo sapiens [TaxId: 9606]} spkvgakpkiehtytggvdsdlgeamsdcdpdgplmchttkmystddgvqfhafgrvlsg tihagqpvkvlgenytledeedsqictvgrlwisvaryhievnrvpagnwvliegvdqpi vktatiteprgneeaqifrplk
Timeline for d6id1c2:
View in 3D Domains from same chain: (mouse over for more information) d6id1c1, d6id1c3, d6id1c4, d6id1c5 |