Lineage for d1lmc__ (1lmc -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405538Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 406000Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 406004Domain d1lmc__: 1lmc - [36592]
    complexed with bul

Details for d1lmc__

PDB Entry: 1lmc (more details), 2 Å

PDB Description: the crystal structure of a complex between bulgecin, a bacterial metabolite, and lysozyme from the rainbow trout

SCOP Domain Sequences for d1lmc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmc__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1lmc__:

Click to download the PDB-style file with coordinates for d1lmc__.
(The format of our PDB-style files is described here.)

Timeline for d1lmc__: