SCOP 1.73: Domain d1lmpa_: 1lmp A:

Lineage for d1lmpa_ (1lmp A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)

8. Domain d1lmpa_: 1lmp A: [36591]
   complexed with nag

Details for d1lmpa_

PDB Entry: 1lmp, 2 Å

PDB Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1lmpa_:

Sequence; same for both SEQRES and ATOM records:

>d1lmpa_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

Timeline for d1lmpa_:

• d1lmpa_ first appeared (with stable ids) in SCOP 1.55, called d1lmp__
  
• d1lmpa_ was called d1lmp__ in SCOP 1.71
  
• d1lmpa_ appears in SCOP 1.75
  
• d1lmpa_ appears in the current release, SCOPe 2.08