SCOP 1.67: Domain d1lmo__: 1lmo -

Lineage for d1lmo__ (1lmo -)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)

8. Domain d1lmo__: 1lmo - [36590]
   complexed with nag

Details for d1lmo__

PDB Entry: 1lmo, 1.8 Å

PDB Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout

SCOP Domain Sequences for d1lmo__:

Sequence; same for both SEQRES and ATOM records:

>d1lmo__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

Timeline for d1lmo__:

• d1lmo__ first appeared (with stable ids) in SCOP 1.55
  
• d1lmo__ appears in SCOP 1.65
  
• d1lmo__ appears in SCOP 1.69
  
• d1lmo__ appears in the current release, SCOPe 2.08, called d1lmoa_