![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries) |
![]() | Domain d1lmo__: 1lmo - [36590] complexed with nag |
PDB Entry: 1lmo (more details), 1.8 Å
SCOP Domain Sequences for d1lmo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmo__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)} kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl rsyvagcgv
Timeline for d1lmo__: