Lineage for d1lmo__ (1lmo -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323347Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tussues ans secretions
  7. 323790Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 323793Domain d1lmo__: 1lmo - [36590]
    complexed with nag

Details for d1lmo__

PDB Entry: 1lmo (more details), 1.8 Å

PDB Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout

SCOP Domain Sequences for d1lmo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmo__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1lmo__:

Click to download the PDB-style file with coordinates for d1lmo__.
(The format of our PDB-style files is described here.)

Timeline for d1lmo__: