Lineage for d1lmoa_ (1lmo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2925528Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 2925531Domain d1lmoa_: 1lmo A: [36590]

Details for d1lmoa_

PDB Entry: 1lmo (more details), 1.8 Å

PDB Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1lmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmoa_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOPe Domain Coordinates for d1lmoa_:

Click to download the PDB-style file with coordinates for d1lmoa_.
(The format of our PDB-style files is described here.)

Timeline for d1lmoa_: