![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
![]() | Protein automated matches [190681] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries) |
![]() | Domain d6g5ub_: 6g5u B: [365895] automated match to d5ogjb_ complexed with cit, edo, enn, zn |
PDB Entry: 6g5u (more details), 1.7 Å
SCOPe Domain Sequences for d6g5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g5ub_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs nhrppqplkgrkvrasfh
Timeline for d6g5ub_: