Lineage for d1lmqa_ (1lmq A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850037Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 850101Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 850664Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 850665Domain d1lmqa_: 1lmq A: [36588]
    complexed with nag

Details for d1lmqa_

PDB Entry: 1lmq (more details), 1.6 Å

PDB Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout
PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1lmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmqa_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1lmqa_:

Click to download the PDB-style file with coordinates for d1lmqa_.
(The format of our PDB-style files is described here.)

Timeline for d1lmqa_: