SCOPe 2.03: Domain d1juga_: 1jug A:

Lineage for d1juga_ (1jug A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Australian echidna (Tachyglossus aculeatus) [TaxId:9261] [53972] (1 PDB entry)

8. Domain d1juga_: 1jug A: [36587]
   complexed with ca

Details for d1juga_

PDB Entry: 1jug, 1.9 Å

PDB Description: lysozyme from echidna milk (tachyglossus aculeatus)

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1juga_:

Sequence; same for both SEQRES and ATOM records:

>d1juga_ d.2.1.2 (A:) Lysozyme {Australian echidna (Tachyglossus aculeatus) [TaxId: 9261]}
kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins
rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl
skfkc

Timeline for d1juga_:

• d1juga_ first appeared (with stable ids) in SCOP 1.55, called d1jug__
  
• d1juga_ appears in SCOPe 2.02
  
• d1juga_ appears in SCOPe 2.04
  
• d1juga_ appears in the current release, SCOPe 2.08