Lineage for d6fmgb_ (6fmg B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491178Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2491179Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2491210Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2491211Protein automated matches [190395] (8 species)
    not a true protein
  7. 2491234Species Streptococcus pneumoniae [TaxId:1313] [365766] (1 PDB entry)
  8. 2491236Domain d6fmgb_: 6fmg B: [365866]
    automated match to d1vsqa_

Details for d6fmgb_

PDB Entry: 6fmg (more details), 1.8 Å

PDB Description: structure of the mannose transporter iia domain from streptococcus pneumoniae
PDB Compounds: (B:) PTS system mannose-specific transporter subunit IIAB

SCOPe Domain Sequences for d6fmgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmgb_ c.54.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
mgsigiiiashgefaagihqsgsmifgeqekvqvvtfmpnegpddlyakfnnavaafdae
devlvladlwsgspfnqasrvmgenperkfaiitglnlpmliqayterlmdaaagvekva
aniikeakdgikalpeelnp

SCOPe Domain Coordinates for d6fmgb_:

Click to download the PDB-style file with coordinates for d6fmgb_.
(The format of our PDB-style files is described here.)

Timeline for d6fmgb_: