Lineage for d6ht9a_ (6ht9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964118Family d.92.1.8: Astacin [55516] (2 proteins)
    automatically mapped to Pfam PF01400
  6. 2964131Protein automated matches [365846] (1 species)
    not a true protein
  7. 2964132Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [365847] (1 PDB entry)
  8. 2964133Domain d6ht9a_: 6ht9 A: [365864]
    automated match to d1iaea_
    complexed with gol, nag, zn

Details for d6ht9a_

PDB Entry: 6ht9 (more details), 3.1 Å

PDB Description: mouse fetuin-b in complex with crayfish astacin
PDB Compounds: (A:) astacin

SCOPe Domain Sequences for d6ht9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ht9a_ d.92.1.8 (A:) automated matches {European fresh water crayfish (Astacus astacus) [TaxId: 6715]}
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecslrh

SCOPe Domain Coordinates for d6ht9a_:

Click to download the PDB-style file with coordinates for d6ht9a_.
(The format of our PDB-style files is described here.)

Timeline for d6ht9a_: