SCOPe 2.08: Domain d6ht9a_: 6ht9 A:

Lineage for d6ht9a_ (6ht9 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.8: Astacin [55516] (2 proteins)
   automatically mapped to Pfam PF01400

6. Protein automated matches [365846] (1 species)
   not a true protein

7. Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [365847] (1 PDB entry)

8. Domain d6ht9a_: 6ht9 A: [365864]
   automated match to d1iaea_
   complexed with gol, nag, zn

Details for d6ht9a_

PDB Entry: 6ht9, 3.1 Å

PDB Description: mouse fetuin-b in complex with crayfish astacin

PDB Compounds: (A:) astacin

SCOPe Domain Sequences for d6ht9a_:

Sequence; same for both SEQRES and ATOM records:

>d6ht9a_ d.92.1.8 (A:) automated matches {European fresh water crayfish (Astacus astacus) [TaxId: 6715]}
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecslrh

Timeline for d6ht9a_:

• d6ht9a_ first appeared in SCOPe 2.07