| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) |
| Domain d6i5ca2: 6i5c A:246-439 [365861] Other proteins in same PDB: d6i5ca1, d6i5cb1, d6i5cc1, d6i5cd1, d6i5ce_, d6i5cf1, d6i5cf2, d6i5cf3 automated match to d1tuba2 complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 6i5c (more details), 2.95 Å
SCOPe Domain Sequences for d6i5ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i5ca2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds
Timeline for d6i5ca2: