SCOPe 2.07: Domain d6frdb_: 6frd B:

Lineage for d6frdb_ (6frd B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)

8. Domain d6frdb_: 6frd B: [365859]
   automated match to d4i15a_
   complexed with e3q, fmt, gai, mg, zn

Details for d6frdb_

PDB Entry: 6frd, 2.2 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-637

PDB Compounds: (B:) phosphodiesterase

SCOPe Domain Sequences for d6frdb_:

Sequence; same for both SEQRES and ATOM records:

>d6frdb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
taitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkfg
csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllita
lvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgleg
aertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisnv
tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
qkivdaclqgmqwtvdriksnraqwervlet

Timeline for d6frdb_:

• d6frdb_ is new in SCOPe 2.07-stable
  
• d6frdb_ appears in the current release, SCOPe 2.08