Lineage for d6frdb_ (6frd B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (10 species)
    not a true protein
  7. 2342891Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)
  8. 3065797Domain d6frdb_: 6frd B: [365859]
    automated match to d4i15a_
    complexed with e3q, fmt, gai, mg, zn

Details for d6frdb_

PDB Entry: 6frd (more details), 2.2 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-637
PDB Compounds: (B:) phosphodiesterase

SCOPe Domain Sequences for d6frdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frdb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
taitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkfg
csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllita
lvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgleg
aertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisnv
tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
qkivdaclqgmqwtvdriksnraqwervlet

SCOPe Domain Coordinates for d6frdb_:

Click to download the PDB-style file with coordinates for d6frdb_.
(The format of our PDB-style files is described here.)

Timeline for d6frdb_:

  • d6frdb_ is new in SCOPe 2.07-stable