SCOPe 2.08: Domain d6i9sb1: 6i9s B:127-223

Lineage for d6i9sb1 (6i9s B:127-223)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6i9sb1: 6i9s B:127-223 [365857]
   automated match to d2dm3a1
   complexed with na

Details for d6i9sb1

PDB Entry: 6i9s, 2.48 Å

PDB Description: hrobo2 extracellular domains 2-3

PDB Compounds: (B:) Roundabout homolog 2

SCOPe Domain Sequences for d6i9sb1:

Sequence; same for both SEQRES and ATOM records:

>d6i9sb1 b.1.1.0 (B:127-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evallrddfrqnptdvvvaagepailecqpprghpeptiywkkdkvriddkeerisirgg
klmisntrksdagmytcvgtnmvgerdsdpaeltvfe

Timeline for d6i9sb1:

• d6i9sb1 first appeared in SCOPe 2.07