SCOPe 2.08: Domain d6frrb_: 6frr B:

Lineage for d6frrb_ (6frr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Artemisia vulgaris [TaxId:4220] [365853] (1 PDB entry)

8. Domain d6frrb_: 6frr B: [365854]
   automated match to d2alga_
   complexed with so4

Details for d6frrb_

PDB Entry: 6frr, 1.95 Å

PDB Description: structural and immunological properties of the allergen art v 3

PDB Compounds: (B:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d6frrb_:

Sequence; same for both SEQRES and ATOM records:

>d6frrb_ a.52.1.0 (B:) automated matches {Artemisia vulgaris [TaxId: 4220]}
mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
dfksdfaaslpskcgvnipykisletdcnkvk

Timeline for d6frrb_:

• d6frrb_ first appeared in SCOPe 2.07