SCOPe 2.07: Domain d6i5cd2: 6i5c D:246-441

Lineage for d6i5cd2 (6i5c D:246-441)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries)

8. Domain d6i5cd2: 6i5c D:246-441 [365852]
   Other proteins in same PDB: d6i5ca1, d6i5cb1, d6i5cc1, d6i5cd1, d6i5ce_, d6i5cf1, d6i5cf2, d6i5cf3
   automated match to d3rycd2
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d6i5cd2

PDB Entry: 6i5c, 2.95 Å

PDB Description: long wavelength native-sad phasing of tubulin-stathmin-ttl complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6i5cd2:

Sequence, based on SEQRES records:

>d6i5cd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records):

>d6i5cd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltltvpeltqqmfdsknmmaacdprhgrylt
vaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignst
aiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

Timeline for d6i5cd2:

• d6i5cd2 is new in SCOPe 2.07-stable
  
• d6i5cd2 appears in the current release, SCOPe 2.08