Lineage for d6i5cd1 (6i5c D:2-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445493Species Sheep (Ovis aries) [TaxId:9940] [224884] (19 PDB entries)
  8. 3065789Domain d6i5cd1: 6i5c D:2-245 [365851]
    Other proteins in same PDB: d6i5ca2, d6i5cb2, d6i5cc2, d6i5cd2, d6i5ce_, d6i5cf1, d6i5cf2, d6i5cf3
    automated match to d4drxb1
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d6i5cd1

PDB Entry: 6i5c (more details), 2.95 Å

PDB Description: long wavelength native-sad phasing of tubulin-stathmin-ttl complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6i5cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5cd1 c.32.1.1 (D:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d6i5cd1:

Click to download the PDB-style file with coordinates for d6i5cd1.
(The format of our PDB-style files is described here.)

Timeline for d6i5cd1:

  • d6i5cd1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-14