Lineage for d6fmgc_ (6fmg C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. Protein automated matches [190395] (8 species)
    not a true protein
  7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [365766] (1 PDB entry)
  8. Domain d6fmgc_: 6fmg C: [365850]
    automated match to d1vsqa_

Details for d6fmgc_

PDB Entry: 6fmg (more details), 1.8 Å

PDB Description: structure of the mannose transporter iia domain from streptococcus pneumoniae
PDB Compounds: (C:) PTS system mannose-specific transporter subunit IIAB

SCOPe Domain Sequences for d6fmgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmgc_ c.54.1.0 (C:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mgsigiiiashgefaagihqsgsmifgeqekvqvvtfmpnegpddlyakfnnavaafdae
devlvladlwsgspfnqasrvmgenperkfaiitglnlpmliqayterlmdaaagvekva
aniikeakdgikalpeelnp

SCOPe Domain Coordinates for d6fmgc_ are not available.

Timeline for d6fmgc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6fmga_, d6fmgb_, d6fmgd_