Lineage for d2eql__ (2eql -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252218Species Horse (Equus caballus), milk [TaxId:9796] [53970] (1 PDB entry)
  8. 252219Domain d2eql__: 2eql - [36585]

Details for d2eql__

PDB Entry: 2eql (more details), 2.5 Å

PDB Description: crystallographic studies of a calcium binding lysozyme from equine milk at 2.5 angstroms resolution
PDB Compounds: ( :)

SCOP Domain Sequences for d2eql__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eql__ d.2.1.2 (-) Lysozyme {Horse (Equus caballus), milk}
kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangssdyglfqln
nkwwckdnkrsssnacnimcsklldenidddiscakrvvrdpkgmsawkawvkhckdkdl
seylascnl

SCOP Domain Coordinates for d2eql__:

Click to download the PDB-style file with coordinates for d2eql__.
(The format of our PDB-style files is described here.)

Timeline for d2eql__: