Lineage for d6f35a_ (6f35 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (141 species)
    not a true protein
  7. 2473034Species Rhizobium meliloti [TaxId:266834] [260118] (3 PDB entries)
  8. 3065763Domain d6f35a_: 6f35 A: [365825]
    automated match to d1u08a_
    complexed with act, gol, plp

Details for d6f35a_

PDB Entry: 6f35 (more details), 1.9 Å

PDB Description: crystal structure of the aspartate aminotranferase from rhizobium meliloti
PDB Compounds: (A:) Aspartate aminotransferase B

SCOPe Domain Sequences for d6f35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f35a_ c.67.1.0 (A:) automated matches {Rhizobium meliloti [TaxId: 266834]}
gfqpasrissigvseilkigaraaamkregkpviilgagepdfdtpehvkqaasdaihrg
etkytaldgtpelkkairekfqrenglayeldeitvatgakqilfnammasldpgdevii
ptpywtsysdivhicegkpvliacdassgfrltaekleaaitprtrwvllnspsnpsgaa
ysaadyrpllevllrhphvwllvddmyehivydgfrfvtpaqlepglknrtltvngvska
yamtgwrigyaggprelikamavvqsqatscpssisqaasvvalngpqdflkertesfqr
rrdlvvnglnaidgldcrvpegafytfsgcagvlgkvtpsgkriktdtdfcaylledahv
avvpgsafglspffrisyatseaelkealeriaaacdrls

SCOPe Domain Coordinates for d6f35a_:

Click to download the PDB-style file with coordinates for d6f35a_.
(The format of our PDB-style files is described here.)

Timeline for d6f35a_:

  • d6f35a_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-14