Lineage for d6fmeb2 (6fme B:435-504)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811020Species Bifidobacterium adolescentis [TaxId:367928] [365789] (1 PDB entry)
  8. 2811022Domain d6fmeb2: 6fme B:435-504 [365822]
    Other proteins in same PDB: d6fmea1, d6fmea3, d6fmea4, d6fmeb1, d6fmeb3
    automated match to d1r7aa1
    complexed with gol

Details for d6fmeb2

PDB Entry: 6fme (more details), 1.51 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d6fmeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmeb2 b.71.1.0 (B:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOPe Domain Coordinates for d6fmeb2:

Click to download the PDB-style file with coordinates for d6fmeb2.
(The format of our PDB-style files is described here.)

Timeline for d6fmeb2: