SCOPe 2.08: Domain d6fmeb1: 6fme B:1-434

Lineage for d6fmeb1 (6fme B:1-434)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (31 species)
   not a true protein

7. Species Bifidobacterium adolescentis [TaxId:367928] [365787] (1 PDB entry)

8. Domain d6fmeb1: 6fme B:1-434 [365821]
   Other proteins in same PDB: d6fmea2, d6fmea3, d6fmea4, d6fmeb2, d6fmeb3
   automated match to d1r7aa2
   complexed with gol

Details for d6fmeb1

PDB Entry: 6fme, 1.51 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol

PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d6fmeb1:

Sequence; same for both SEQRES and ATOM records:

>d6fmeb1 c.1.8.1 (B:1-434) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

Timeline for d6fmeb1:

• d6fmeb1 first appeared in SCOPe 2.07