Lineage for d6fqea_ (6fqe A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries)
    Uniprot P0A434 30-365
  8. Domain d6fqea_: 6fqe A: [365819]
    Other proteins in same PDB: d6fqeb2
    automated match to d1qw7a_
    complexed with d6k, fmt, peg, zn

Details for d6fqea_

PDB Entry: 6fqe (more details), 1.7500000000000002 Å

PDB Description: phosphotriesterase pte_a53_4
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d6fqea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fqea_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt

SCOPe Domain Coordinates for d6fqea_ are not available.

Timeline for d6fqea_:

Domains from other chains:
(mouse over for more information)
d6fqeb1, d6fqeb2