SCOPe 2.07: Domain d6e23b_: 6e23 B:

Lineage for d6e23b_ (6e23 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries)

8. Domain d6e23b_: 6e23 B: [365805]
   automated match to d4gm9b_
   protein/DNA complex; complexed with epe, hlj

Details for d6e23b_

PDB Entry: 6e23, 1.66 Å

PDB Description: displacement of wdr5 from chromatin by a pharmacological win site inhibitor with picomolar affinity

PDB Compounds: (B:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6e23b_:

Sequence; same for both SEQRES and ATOM records:

>d6e23b_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgis
dvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfde
svriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktlid
ddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtgg
kwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwk
sdc

Timeline for d6e23b_:

• d6e23b_ is new in SCOPe 2.07-stable
  
• d6e23b_ appears in the current release, SCOPe 2.08