Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries) |
Domain d6fqka_: 6fqk A: [365804] automated match to d4h8ja_ complexed with zk1 |
PDB Entry: 6fqk (more details), 1.98 Å
SCOPe Domain Sequences for d6fqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fqka_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldckgygiatpkgsslgnavnlavlklne qglldklknkwwydkgecg
Timeline for d6fqka_: