Lineage for d6fmea1 (6fme A:1-434)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830383Species Bifidobacterium adolescentis [TaxId:367928] [365787] (1 PDB entry)
  8. 2830384Domain d6fmea1: 6fme A:1-434 [365788]
    Other proteins in same PDB: d6fmea2, d6fmea3, d6fmea4, d6fmeb2, d6fmeb3
    automated match to d1r7aa2
    complexed with gol

Details for d6fmea1

PDB Entry: 6fme (more details), 1.51 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol
PDB Compounds: (A:) sucrose phosphorylase

SCOPe Domain Sequences for d6fmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmea1 c.1.8.1 (A:1-434) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

SCOPe Domain Coordinates for d6fmea1:

Click to download the PDB-style file with coordinates for d6fmea1.
(The format of our PDB-style files is described here.)

Timeline for d6fmea1: