Lineage for d6fpla2 (6fpl A:68-208)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. Domain d6fpla2: 6fpl A:68-208 [365774]
    Other proteins in same PDB: d6fpla1
    automated match to d2xpwa2
    complexed with cl, mg, tac; mutant

Details for d6fpla2

PDB Entry: 6fpl (more details), 1.6 Å

PDB Description: tetr(d) e147a mutant in complex with tetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6fpla2:

Sequence, based on SEQRES records: (download)

>d6fpla2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavlaqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d6fpla2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavlaqqehtaalnlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

SCOPe Domain Coordinates for d6fpla2 are not available.

Timeline for d6fpla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fpla1