Lineage for d6e1za_ (6e1z A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399432Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2399433Protein automated matches [190568] (9 species)
    not a true protein
  7. 2399473Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries)
  8. 3065700Domain d6e1za_: 6e1z A: [365762]
    automated match to d4gm9b_
    protein/DNA complex; complexed with hlp

Details for d6e1za_

PDB Entry: 6e1z (more details), 1.1 Å

PDB Description: displacement of wdr5 from chromatin by a pharmacological win site inhibitor with picomolar affinity
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6e1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e1za_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghk
lgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsg
sfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclk
tlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfs
vtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendkti
klwksdc

SCOPe Domain Coordinates for d6e1za_:

Click to download the PDB-style file with coordinates for d6e1za_.
(The format of our PDB-style files is described here.)

Timeline for d6e1za_:

  • d6e1za_ is new in SCOPe 2.07-stable