Lineage for d6f26b_ (6f26 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries)
  8. Domain d6f26b_: 6f26 B: [365761]
    automated match to d1ckia_
    complexed with c9z, so4

Details for d6f26b_

PDB Entry: 6f26 (more details), 1.83 Å

PDB Description: crystal structure of human casein kinase i delta in complex with compound 31b
PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d6f26b_:

Sequence, based on SEQRES records: (download)

>d6f26b_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqgg
vgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsk
nfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasi
nthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlck
gypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

Sequence, based on observed residues (ATOM records): (download)

>d6f26b_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
lrvgnryrlgrkigdiylgtdiaageevaiklecvqlhieskiykmmqggvgiptirwcg
aegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkpd
nflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqsr
rddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatyl
nfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

SCOPe Domain Coordinates for d6f26b_ are not available.

Timeline for d6f26b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6f26a_