SCOP 1.75: Domain d2meca_: 2mec A:

Lineage for d2meca_ (2mec A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
   Uniprot P00695

8. Domain d2meca_: 2mec A: [36576]

Details for d2meca_

PDB Entry: 2mec, 2.2 Å

PDB Description: changes in conformational stability of a series of mutant human lysozymes at constant positions

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d2meca_:

Sequence; same for both SEQRES and ATOM records:

>d2meca_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygmfqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d2meca_:

• d2meca_ first appeared (with stable ids) in SCOP 1.55
  
• d2meca_ appears in SCOP 1.73
  
• d2meca_ appears in SCOPe 2.01
  
• d2meca_ appears in the current release, SCOPe 2.08