Lineage for d2meca_ (2mec A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28961Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries)
  8. 29130Domain d2meca_: 2mec A: [36576]

Details for d2meca_

PDB Entry: 2mec (more details), 2.2 Å

PDB Description: changes in conformational stability of a series of mutant human lysozymes at constant positions

SCOP Domain Sequences for d2meca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2meca_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygmfqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2meca_:

Click to download the PDB-style file with coordinates for d2meca_.
(The format of our PDB-style files is described here.)

Timeline for d2meca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mecb_