Lineage for d6cjob_ (6cjo B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511324Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2511325Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2511326Family d.36.1.1: Chalcone isomerase [54627] (2 proteins)
  6. 3065665Protein automated matches [365727] (1 species)
    not a true protein
  7. 3065666Species Medicago sativa [TaxId:3879] [365728] (2 PDB entries)
  8. 3065683Domain d6cjob_: 6cjo B: [365745]
    automated match to d1jx1d_
    complexed with so4; mutant

Details for d6cjob_

PDB Entry: 6cjo (more details), 2.4 Å

PDB Description: crystal structure of chalcone isomerase from medicago sativa with the g95s mutation.
PDB Compounds: (B:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d6cjob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cjob_ d.36.1.1 (B:) automated matches {Medicago sativa [TaxId: 3879]}
aasitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavas
laakwkgksseelletldfyrdiisgpfeklirsskirelsgpeysrkvmencvahlksv
gtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienk
avssavletmigehavspdlkrclaarlpallnegafkig

SCOPe Domain Coordinates for d6cjob_:

Click to download the PDB-style file with coordinates for d6cjob_.
(The format of our PDB-style files is described here.)

Timeline for d6cjob_:

  • d6cjob_ is new in SCOPe 2.07-stable