Lineage for d6cjna_ (6cjn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943206Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2943207Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2943208Family d.36.1.1: Chalcone isomerase [54627] (2 proteins)
  6. 2943229Protein automated matches [365727] (1 species)
    not a true protein
  7. 2943230Species Alfalfa (Medicago sativa) [TaxId:3879] [365728] (2 PDB entries)
  8. 2943233Domain d6cjna_: 6cjn A: [365742]
    automated match to d1jx1d_
    complexed with so4; mutant

Details for d6cjna_

PDB Entry: 6cjn (more details), 2.4 Å

PDB Description: crystal structure of chalcone isomerase from medicago sativa with the g95t mutation
PDB Compounds: (A:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d6cjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cjna_ d.36.1.1 (A:) automated matches {Alfalfa (Medicago sativa) [TaxId: 3879]}
asitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasl
aakwkgksseelletldfyrdiisgpfeklirtskirelsgpeysrkvmencvahlksvg
tygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienka
vssavletmigehavspdlkrclaarlpallnegafkig

SCOPe Domain Coordinates for d6cjna_:

Click to download the PDB-style file with coordinates for d6cjna_.
(The format of our PDB-style files is described here.)

Timeline for d6cjna_: