Lineage for d6cl4a_ (6cl4 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (108 species)
    not a true protein
  7. 2477367Species Uncultured bacterium [TaxId:77133] [196706] (27 PDB entries)
  8. 3065671Domain d6cl4a_: 6cl4 A: [365733]
    automated match to d1cvla_

Details for d6cl4a_

PDB Entry: 6cl4 (more details), 2.64 Å

PDB Description: lipc12 - lipase from metagenomics
PDB Compounds: (A:) Lipase C12

SCOPe Domain Sequences for d6cl4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cl4a_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
sslkfpivlvhgllgfdkiggiypyfygikealekagakvyiatlsalnsnelrgeqlle
fvrkvqaetgaakvnlighsqgplacryvaathpeliasvtsvngvnhgsevadlvrlal
tpgrlpesianaamsafgqllsalagsprlpqsgiealealtsegvaafnnkypqglpae
wggegkelvngvyyyswsgvidynplhqgannldplhvamlafsilftnerfqndglvgr
ysshlgkvigsdysmdhvdainqlagvvanntdpvqlfvehvarlkskgl

SCOPe Domain Coordinates for d6cl4a_:

Click to download the PDB-style file with coordinates for d6cl4a_.
(The format of our PDB-style files is described here.)

Timeline for d6cl4a_:

  • d6cl4a_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-14