Lineage for d6cjoa_ (6cjo A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. Family d.36.1.1: Chalcone isomerase [54627] (2 proteins)
  6. Protein automated matches [365727] (1 species)
    not a true protein
  7. Species Alfalfa (Medicago sativa) [TaxId:3879] [365728] (2 PDB entries)
  8. Domain d6cjoa_: 6cjo A: [365732]
    automated match to d1jx1d_
    complexed with so4; mutant

Details for d6cjoa_

PDB Entry: 6cjo (more details), 2.4 Å

PDB Description: crystal structure of chalcone isomerase from medicago sativa with the g95s mutation.
PDB Compounds: (A:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d6cjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cjoa_ d.36.1.1 (A:) automated matches {Alfalfa (Medicago sativa) [TaxId: 3879]}
asitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasl
aakwkgksseelletldfyrdiisgpfeklirsskirelsgpeysrkvmencvahlksvg
tygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienka
vssavletmigehavspdlkrclaarlpallnegafkign

SCOPe Domain Coordinates for d6cjoa_ are not available.

Timeline for d6cjoa_:

Domains from other chains:
(mouse over for more information)
d6cjob_