Lineage for d6cffa_ (6cff A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. Protein Tyrosinase cofactor MelC1 [254420] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [254863] (47 PDB entries)
  8. Domain d6cffa_: 6cff A: [365726]
    automated match to d4f5wa_
    complexed with 2ba

Details for d6cffa_

PDB Entry: 6cff (more details), 2.4 Å

PDB Description: stimulator of interferon genes human
PDB Compounds: (A:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d6cffa_:

Sequence, based on SEQRES records: (download)

>d6cffa_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
nvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
madpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfamsq
ysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhl
rq

Sequence, based on observed residues (ATOM records): (download)

>d6cffa_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
nvahglawsyyigylrlilpelqarirtynqavsqrlyillpldcgvpdnlsmadpnirf
ldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfamsqysqagfsr
edrleqaklfcrtlediladapesqnncrliayqepslsqevlrhlrq

SCOPe Domain Coordinates for d6cffa_ are not available.

Timeline for d6cffa_: