Lineage for d6agtd1 (6agt D:79-224)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400192Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries)
  8. 2400202Domain d6agtd1: 6agt D:79-224 [365722]
    Other proteins in same PDB: d6agta2, d6agtb2, d6agtc2, d6agtd2
    automated match to d3bjua1
    complexed with 9x0, co, fmt, lys, mla

Details for d6agtd1

PDB Entry: 6agt (more details), 1.95 Å

PDB Description: crystal structure of pfkrs complexed with chromone inhibitor
PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6agtd1:

Sequence, based on SEQRES records: (download)

>d6agtd1 b.40.4.0 (D:79-224) automated matches {Plasmodium falciparum [TaxId: 5843]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
skkgelsifpketillsaclhmlpmk

Sequence, based on observed residues (ATOM records): (download)

>d6agtd1 b.40.4.0 (D:79-224) automated matches {Plasmodium falciparum [TaxId: 5843]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgkskkg
elsifpketillsaclhmlpmk

SCOPe Domain Coordinates for d6agtd1:

Click to download the PDB-style file with coordinates for d6agtd1.
(The format of our PDB-style files is described here.)

Timeline for d6agtd1: