Lineage for d2meaa_ (2mea A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (13 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries) 
Domain d2meaa_: 2mea A: [36572]
Details for d2meaa_
PDB Entry: 2mea (more details), 2.2 Å
PDB Description: changes in conformational stability of a series of mutant human lysozymes at constant positions
SCOP Domain Sequences for d2meaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2meaa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygffqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d2meaa_:
Click to download the PDB-style file with coordinates for d2meaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2meaa_:
- d2meaa_ appears in SCOP 1.57
- d2meaa_ appears in the current release, SCOPe 2.08
View in 3D
