Lineage for d6agya_ (6agy A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. Protein automated matches [191087] (19 species)
    not a true protein
  7. Species Aspergillus fumigatus [TaxId:330879] [365715] (8 PDB entries)
  8. Domain d6agya_: 6agy A: [365716]
    automated match to d4fkxa_

Details for d6agya_

PDB Entry: 6agy (more details), 1.8 Å

PDB Description: aspergillus fumigatus af293 ndk
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6agya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6agya_ d.58.6.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
sneqtfiaikpdgvqrgligpiisrfenrgfklvamklvsppqsqleqhyadlsdkpffk
glvsymlsgpicamvwegrdvvktgrtilgatnplasapgtirgdfaidvgrnvchgsds
venakkeialwfkpeeliswksatfdwvy

SCOPe Domain Coordinates for d6agya_ are not available.

Timeline for d6agya_: