Lineage for d5zhja_ (5zhj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492420Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2492421Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2492493Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2492506Protein automated matches [196235] (4 species)
    not a true protein
  7. 3065645Species Mycobacterium tuberculosis [TaxId:83332] [365707] (3 PDB entries)
  8. 3065650Domain d5zhja_: 5zhj A: [365712]
    automated match to d1oy5a_
    protein/RNA complex; complexed with gol, sah

Details for d5zhja_

PDB Entry: 5zhj (more details), 1.75 Å

PDB Description: crystal structure of trmd from mycobacterium tuberculosis in complex with s-adenosyl homocysteine (sah)
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d5zhja_:

Sequence, based on SEQRES records: (download)

>d5zhja_ c.116.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdl

Sequence, based on observed residues (ATOM records): (download)

>d5zhja_ c.116.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllagvlgpsytrpaswrgldvpevll
sgdhariaawrrevslqrtrerrpdl

SCOPe Domain Coordinates for d5zhja_:

Click to download the PDB-style file with coordinates for d5zhja_.
(The format of our PDB-style files is described here.)

Timeline for d5zhja_:

  • d5zhja_ is new in SCOPe 2.07-stable