Lineage for d1b5ya_ (1b5y A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129322Species Human (Homo sapiens) [TaxId:9606] [53969] (181 PDB entries)
  8. 129500Domain d1b5ya_: 1b5y A: [36570]

Details for d1b5ya_

PDB Entry: 1b5y (more details), 2.2 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants

SCOP Domain Sequences for d1b5ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5ya_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakweagyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1b5ya_:

Click to download the PDB-style file with coordinates for d1b5ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b5ya_: