Lineage for d5zf3a_ (5zf3 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. Species Hypocrea jecorina [TaxId:1344414] [365691] (11 PDB entries)
  8. Domain d5zf3a_: 5zf3 A: [365692]
    automated match to d4xqdb_
    complexed with gol, iod, xyp

Details for d5zf3a_

PDB Entry: 5zf3 (more details), 1.2 Å

PDB Description: crystal structures of endo-beta-1,4-xylanase ii complexed with xylotriose
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d5zf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zf3a_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 1344414]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

SCOPe Domain Coordinates for d5zf3a_ are not available.

Timeline for d5zf3a_: