SCOPe 2.07: Domain d1b5zb_: 1b5z B:

Lineage for d1b5zb_ (1b5z B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (15 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
   Uniprot P00695

8. Domain d1b5zb_: 1b5z B: [36568]
   mutant

Details for d1b5zb_

PDB Entry: 1b5z, 2.2 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d1b5zb_:

Sequence; same for both SEQRES and ATOM records:

>d1b5zb_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscaallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1b5zb_:

• d1b5zb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b5zb_ appears in SCOPe 2.06
  
• d1b5zb_ appears in the current release, SCOPe 2.08