Lineage for d1b5za_ (1b5z A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1190400Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1190460Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1190789Species Human (Homo sapiens) [TaxId:9606] [53969] (208 PDB entries)
    Uniprot P00695
  8. 1191001Domain d1b5za_: 1b5z A: [36567]
    mutant

Details for d1b5za_

PDB Entry: 1b5z (more details), 2.2 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1b5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5za_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscaallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1b5za_:

Click to download the PDB-style file with coordinates for d1b5za_.
(The format of our PDB-style files is described here.)

Timeline for d1b5za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b5zb_