Lineage for d1loz__ (1loz -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 187345Protein Lysozyme [53961] (16 species)
  7. 187536Species Human (Homo sapiens) [TaxId:9606] [53969] (183 PDB entries)
  8. 187720Domain d1loz__: 1loz - [36566]

Details for d1loz__

PDB Entry: 1loz (more details), 1.8 Å

PDB Description: amyloidogenic variant (i56t) variant of human lysozyme
PDB Compounds: ( :)

SCOP Domain Sequences for d1loz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loz__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtfqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1loz__:

Click to download the PDB-style file with coordinates for d1loz__.
(The format of our PDB-style files is described here.)

Timeline for d1loz__: