SCOPe 2.08: Domain d6ioqa1: 6ioq A:30-263

Lineage for d6ioqa1 (6ioq A:30-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.0: automated matches [345975] (1 protein)
   not a true family

6. Protein automated matches [346107] (2 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [365619] (6 PDB entries)

8. Domain d6ioqa1: 6ioq A:30-263 [365656]
   Other proteins in same PDB: d6ioqa2
   automated match to d5ltxb_
   complexed with ca, gly

Details for d6ioqa1

PDB Entry: 6ioq, 2.14 Å

PDB Description: the ligand binding domain of mlp24 with glycine

PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d6ioqa1:

Sequence; same for both SEQRES and ATOM records:

>d6ioqa1 d.110.6.0 (A:30-263) automated matches {Vibrio cholerae [TaxId: 666]}
vreeieslvqdslmemvkgvkntiesdlaskkglaqstteilqldptnkafaksvlespn
lkgsflaiglgyesdatvvenddgwepnadydprkrpwyvdakrerklvvtepyvdistk
kiiisigtpvyqqsnfvgamfydveltqlaqlvnsvnlfdagylfittkdgvtiahpnae
nngekfsqflpnvdlkegtqrieldgkyylvkfaqvpseswyigavvdesiafa

Timeline for d6ioqa1:

• d6ioqa1 first appeared in SCOPe 2.07