![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.0: automated matches [345975] (1 protein) not a true family |
![]() | Protein automated matches [346107] (2 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [365619] (6 PDB entries) |
![]() | Domain d6ioqa1: 6ioq A:30-263 [365656] Other proteins in same PDB: d6ioqa2 automated match to d5ltxb_ complexed with ca, gly |
PDB Entry: 6ioq (more details), 2.14 Å
SCOPe Domain Sequences for d6ioqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ioqa1 d.110.6.0 (A:30-263) automated matches {Vibrio cholerae [TaxId: 666]} vreeieslvqdslmemvkgvkntiesdlaskkglaqstteilqldptnkafaksvlespn lkgsflaiglgyesdatvvenddgwepnadydprkrpwyvdakrerklvvtepyvdistk kiiisigtpvyqqsnfvgamfydveltqlaqlvnsvnlfdagylfittkdgvtiahpnae nngekfsqflpnvdlkegtqrieldgkyylvkfaqvpseswyigavvdesiafa
Timeline for d6ioqa1: