Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (19 species) |
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries) |
Domain d6nblc_: 6nbl C: [365650] Other proteins in same PDB: d6nbla_, d6nblb_, d6nbld2 automated match to d4jx1c_ complexed with 1n0, ca, cam, cyn, fes, hem |
PDB Entry: 6nbl (more details), 2.15 Å
SCOPe Domain Sequences for d6nblc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nblc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d6nblc_:
View in 3D Domains from other chains: (mouse over for more information) d6nbla_, d6nblb_, d6nbld1, d6nbld2 |